← All Tags

#privacy

41 episodes

#1234: Digital Plutonium: Bridging the Anonymization Gap

Learn how to bridge the "anonymization gap" and protect sensitive data without destroying its utility for analysis.

privacytokenizationdata-integrity

#1082: The Analytics Paradox: Privacy and Performance in 2026

Stop slowing down your site with invasive trackers. Learn how to balance privacy and performance using edge-side and proxy-based analytics.

privacyarchitecturedata-integrity

#1074: The $200 Information Tax: Why News Bundling is Broken

Tired of hitting paywalls? We explore why a "Spotify for news" doesn't exist and how AI might finally force the industry to change.

ai-agentsprivacynetworking

#1071: Beyond the Kill Switch: Advanced Router VPN Routing

Stop breaking your smart home. Learn how to use domain-based split routing and WireGuard to gain surgical control over your network.

networkingprivacysmart-home

#1053: The Soul and the Shield: Mastering Signature Management

Learn how to stay safe in a high-threat world by reducing your physical and digital signature without losing your sense of identity.

privacysituational-awarenessexecutive-protection

#990: Privacy in the Bin: Mastering Physical InfoSec

Is your trash a gold mine for identity thieves? Learn the essentials of physical InfoSec and how to properly destroy sensitive documents.

privacyphysical-securityfinancial-fraud

#985: Banking on Surveillance: The Secret History of KYC

How did opening a bank account become a security clearance? Trace the evolution of KYC from the 1970s to the age of AI surveillance.

surveillance-technologyprivacypolitical-historykyc-regulationsanti-money-laundering

#980: The Rosehill Audit: Mapping a Digital Footprint

From Linux automation to AI prompts, discover the digital blueprint of a modern systems builder in this deep-dive investigative audit.

prompt-engineeringprivacylocal-ai

#963: The Truth Behind Iran’s Digital Iron Curtain

How do we measure public opinion in a state where dissent is a crime? Explore the data behind Iran’s hidden social and political reality.

privacynetworkingdata-integrity

#960: Why Your $2,000 Smart TV Lags Like a Budget Phone

Why does a $2,000 TV struggle with basic menus? Discover the hidden "Smart TV Tax" and why your display's brain is often stuck in the past.

smart-homearchitectureprivacy

#952: The OSINT Paradox: How Public Data Redefines Intelligence

Explore how OSINT evolved from a niche hobby into a billion-dollar industry that rivals state intelligence agencies in the modern age.

osintsituational-awarenessprivacy

#864: The Death of SaaS: Building Your Own Bespoke AI Tools

Stop paying for dozens of subscriptions. Learn how AI agents are allowing anyone to build custom, private software tailored to their exact needs.

ai-agentsprivacysoftware-development

#801: Smart Contracts: Solving Landlords and Salary Secrets

Can blockchain fix bad landlords and hidden salaries? Explore how smart contracts and Zero-Knowledge Proofs are rebuilding trust in 2026.

smart-contractsprivacydata-integrity

#798: Beyond the Button: How AI Learns From Your Feedback

Ever wonder if your AI feedback actually matters? Discover how ratings shape global models and the privacy tech keeping your data safe.

fine-tuningprivacydata-integrity

#796: Digital Borders: The Rise of Data Sovereignty

Explore the shift from a global cloud to localized data sovereignty and why legal jurisdictions are the new physical borders of 2026.

privacynetworkingdata-sovereignty

#780: Escaping the Golden Cage: The Guide to De-Googling in 2026

Is it possible to leave Google in 2026? Explore the tools and trade-offs of reclaiming your digital sovereignty from the AI-driven golden cage.

privacydigital-sovereigntyde-googling

#776: The Silent Ping: How Email Tracking Pixels Spy on You

A tiny 1x1 image is watching your every move. Explore how tracking pixels turn your inbox into a surveillance tool and how to fight back.

privacyfingerprintingemail-tracking

#723: Domesticating Your Home Security: How to Kill the Cloud

Learn how to "domesticate" consumer security cameras by severing their cloud ties while keeping the high-quality hardware you love.

smart-homeprivacynetworking

#703: The Spam Explosion: Why Your Phone Won't Stop Buzzing

Why is your inbox overflowing? Explore the technical and economic reasons behind the relentless rise of digital and physical spam.

telecommunicationsprivacysocial-engineering

#659: The Voice Biometric Dilemma: Security in the Age of AI

Explore why voice biometrics hasn't replaced Face ID and how generative AI is making "voice prints" a massive security risk.

privacysocial-engineeringbiometrics

#629: The Earth is Metadata: AI’s New Geolocation Powers

Every pixel is a secret. Herman and Corn discuss how AI and OSINT are turning clouds and shadows into a global tracking system.

privacygeolocationosint

#569: The End of the Blur: High-Res Satellites over Israel

From 2-meter blurs to 40cm clarity: Herman and Corn explore how shifting satellite laws are changing the face of Israeli security.

satellite-imagerysituational-awarenessprivacy

#564: Beyond the Factory Reset: How to Truly Erase Your Data

Think a factory reset protects your old data? Herman and Corn reveal why your digital "ghosts" might still be lurking on your old devices.

data-storagedata-securityprivacye-wastedigital-forensics

#557: Before They Can Click: The Ethics of Sharenting

Explore the ethical and technical landmines of sharing children's photos online, from metadata leaks to the rise of AI-generated deepfakes.

privacychild-developmentdigital-identity

#518: The Economic Thermostat: How Central Banks Rule the World

Ever wonder why inflation targets exist? Herman and Corn demystify the Bank of Israel and the high-stakes world of central banking.

central-bankingdigital-currencyprivacy

#471: Beyond the Swipe: The High-Stakes World of Digital Wallets

Is your credit card chip actually safe? Explore the hidden risks of shimming and why digital wallets have become the gold standard for security.

financial-fraudprivacyopen-banking

#468: Mapping the Future: From Robot Vacuums to Digital Twins

Discover how LiDAR is moving from expensive rigs to our pockets, bridging the gap between physical reality and digital models.

architectureprivacyspatial-computing

#384: The Whistleblower’s Shield: AI and the End of Scams

Can AI protect those who expose the truth? Explore the future of whistleblowing, from multi-million dollar bounties to anonymous digital twins.

financial-fraudwhistleblower-protectionprivacy

#381: The Invisible Hack: The Rise of Zero-Click Exploits

Imagine getting hacked without ever clicking a link. Herman and Corn explore the terrifying world of zero-click exploits and Pegasus spyware.

privacyexecutive-protectionzero-day-exploits

#374: The Walls Have Eyes: The Reality of Hidden Travel Cameras

From power plugs to smoke detectors, hidden cameras are easier to hide than ever. Learn how to protect your privacy while traveling.

privacysmart-home

#223: Beyond the Blackout: Tech for Digital Survival

When the grid goes dark, how do you get the truth out? Explore the high-stakes world of BGP hijacking, satellite jamming, and mesh networks.

networkingprivacy

#152: Eyes on the Move: Choosing the Best Baby Tracking Cameras

Herman and Corn explore the best camera tech for tracking a crawling baby, from dual-lens systems to AI-powered motion detection.

baby-monitorhome-securityai-cameraptz-cameradual-lens

#150: The Silent Killer: Can AI Stop the Urban Honking Crisis?

Urban noise is more than an annoyance—it’s a health crisis. Discover how AI sensors are being used to silence the streets and the privacy costs.

noise-pollutionurban-noisehealthprivacysensors

#89: The Digital Twin Dilemma: Can AI Truly Understand You?

From "digital twins" to "digital nannies," Herman and Corn explore the engineering gap between smart encyclopedias and AI that knows your soul.

privacylocal-ailarge-language-models

#88: Why Won't My AI Talk to Me First?

Why is AI always waiting for us? Herman and Corn explore the technical and social hurdles of proactive AI and the "vending machine" model.

ai-agentsprivacystateless-architecture

#73: VPNs: Privacy Myth vs. Reality

VPNs: privacy savior or marketing hype? We expose the truth behind the grand claims and technical realities.

vpnsprivacysecuritydigital-privacyinternet-security

#71: Dark Web Deception: Google's Monitoring Shift

Google's "dark web monitoring" isn't what you think. We reveal the hidden corners of the internet and Google's true capabilities.

dark-webgooglemonitoringdeep-webinternet-security

#59: The Hidden Watermarks in Your AI: Privacy or Protection?

Invisible watermarks in AI? Is it privacy or protection? We uncover the hidden truth behind AI-generated content.

watermarksprivacysynthiddeepfakesconsent

#40: Unlocking Local AI: Privacy, Creativity & Compliance

Local AI: privacy, creativity, and compliance. Discover why keeping AI close to home is more than a trend.

local-aiprivacycompliancecreativitydata-privacy

#39: SLMs: Precision Power Beyond LLMs

Forget LLMs. Discover SLMs: the specialized, efficient AI powerhouses transforming workflows, from planning to edge devices.

small-language-modelslocal-aiprivacy

#16: On Deepfakes, SynthID, And AI Watermarking

Deepfakes, SynthID, and AI watermarking. Could your AI creations be traced back to you?

privacydeepfake-detectionai-watermarking